alurmo
improooving the forym
- Joined
- May 5, 2024
- Posts
- 36,994
- Reputation
- 64,506
For the retarded stinky finite no aura silly newfags and greys to tire and leave.
and concerning the rest of the pslsphere If forums are up along side each other, it means that the already diluted userbase becomes even more diluted. We should rejoice in this fact however, since the retards who come just to post retarded dopamine dumps wont be recieving any answers to their threads and will move along to some other shit forum thus we can slowly start working on building a quality user base and get the high quality users to post more and redeem peaks again
another realisation i made was that reason that lookism/early org got a lot of traffic and was growing was because of the interesting users on there, imagine checking out the forum on 2020 and seeing skitzos like kj, undisputed(albeit he was not even active on org) the og crews, short brown and ugly saga, etc. the trolls that were there were actually very entertaining asw
On this forum weve basically given carte blanche to retarded zoomers who came from tiktok and hence weve seen quality plummet, however this proccess isnt fully to blame on us, as much as its been said over 10000x, mainstreamdom and CLAVVVVVVVVVVFAGGNIGGERTWINKDYELCOPINGPSEUDOAUTISTGOODLIFERFAKECELNORMIEFREAKABOMINATIONTHATSHOULDKILHIMSELF who namedropped this forum and scammed kiddies out their parents money bc he knows how to reword threads from org, has been a big factor in the deteriation of org, thus the argument of me nostalgiabaiting cant really be refuted when we are looking at this through the lens of looksmaxxing, the best threads came pre mainstreamdom
The best thing to do if you dont belong to this category of low iq zoomer dopaminfrogs is to use the excellent ignore function to ignore at the very least 70% of the userbase on here bc 90% of them are actual retards
The problem with the new splinter sites asw is that most of them are practically the same shit as here, maybe with better advertisement and a lower userbase, more or less they bring nothing else to the table except another forum for the banned users to go to
on those splinter sites the same retarded zoomers are allowed to post, and this is because the sites are likely administered by literal retards who just wanted a escape from org without changing anything
So best just to use the ignore function on here, hope that the retards eventually go away and hope that the name on here eventually gets changed/domain switch
HOWEVER MASTER WONT DO ANY OF DIS NOR DOES HE CARE ABOUT US, INB4 ANOTHER MONEYMAKING DISCOUNT YA KUCH AUR
@Banned User @Former Shortcel @LowTierBateman (ye gears oughta get worked Gs)
and concerning the rest of the pslsphere If forums are up along side each other, it means that the already diluted userbase becomes even more diluted. We should rejoice in this fact however, since the retards who come just to post retarded dopamine dumps wont be recieving any answers to their threads and will move along to some other shit forum thus we can slowly start working on building a quality user base and get the high quality users to post more and redeem peaks again
another realisation i made was that reason that lookism/early org got a lot of traffic and was growing was because of the interesting users on there, imagine checking out the forum on 2020 and seeing skitzos like kj, undisputed(albeit he was not even active on org) the og crews, short brown and ugly saga, etc. the trolls that were there were actually very entertaining asw
On this forum weve basically given carte blanche to retarded zoomers who came from tiktok and hence weve seen quality plummet, however this proccess isnt fully to blame on us, as much as its been said over 10000x, mainstreamdom and CLAVVVVVVVVVVFAGGNIGGERTWINKDYELCOPINGPSEUDOAUTISTGOODLIFERFAKECELNORMIEFREAKABOMINATIONTHATSHOULDKILHIMSELF who namedropped this forum and scammed kiddies out their parents money bc he knows how to reword threads from org, has been a big factor in the deteriation of org, thus the argument of me nostalgiabaiting cant really be refuted when we are looking at this through the lens of looksmaxxing, the best threads came pre mainstreamdom
The best thing to do if you dont belong to this category of low iq zoomer dopaminfrogs is to use the excellent ignore function to ignore at the very least 70% of the userbase on here bc 90% of them are actual retards
The problem with the new splinter sites asw is that most of them are practically the same shit as here, maybe with better advertisement and a lower userbase, more or less they bring nothing else to the table except another forum for the banned users to go to
on those splinter sites the same retarded zoomers are allowed to post, and this is because the sites are likely administered by literal retards who just wanted a escape from org without changing anything
So best just to use the ignore function on here, hope that the retards eventually go away and hope that the name on here eventually gets changed/domain switch
HOWEVER MASTER WONT DO ANY OF DIS NOR DOES HE CARE ABOUT US, INB4 ANOTHER MONEYMAKING DISCOUNT YA KUCH AUR
@Banned User @Former Shortcel @LowTierBateman (ye gears oughta get worked Gs)
